DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Klrh1

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_631926.1 Gene:Klrh1 / 246043 RGDID:621452 Length:231 Species:Rattus norvegicus


Alignment Length:131 Identity:33/131 - (25%)
Similarity:46/131 - (35%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTH 112
            |..|.|.:.:..|..:..:||.|.|.|...:..||.:.|.:.||     ..:|..   |.|.|..
  Rat   113 EKCYYFSEEEKTWDESEASCRLLGSHLAKIDNREEQNFIQSRLN-----YSYWVG---LRKKGGQ 169

  Fly   113 YWFSNAQLVTIKRWAPKQPDNAGGREHCIHL-----GYIYGYSTEFQLNDRPCHNHASSLFKYIC 172
            :           .|. .|.|.....:...|:     ....||.....||:..|    |.||.|||
  Rat   170 F-----------LWV-HQEDEKISSDLDFHMTTHLADAACGYIKPKLLNNAQC----SRLFPYIC 218

  Fly   173 E 173
            :
  Rat   219 K 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/128 (24%)
Klrh1NP_631926.1 Ly49 36..118 CDD:285577 2/4 (50%)
CLECT_NK_receptors_like 104..220 CDD:153063 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.