DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Asgr1

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_036635.1 Gene:Asgr1 / 24210 RGDID:2160 Length:284 Species:Rattus norvegicus


Alignment Length:137 Identity:33/137 - (24%)
Similarity:51/137 - (37%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLG 107
            :::...|.|.|..:...|..|.:.|:...:.||...:.||    ..|:.........|....|  
  Rat   157 WVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEE----QRFVQQHMGPLNTWIGLTD-- 215

  Fly   108 KTGTHYWFSNAQLVT-IKRWAPKQPDN-----AGGREHCIHLGYIYGYSTEFQLNDRPCHNHASS 166
            :.|...|.......| .|.|.|.|||:     .||.|.|.|      ::|:...||..|...   
  Rat   216 QNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAH------FTTDGHWNDDVCRRP--- 271

  Fly   167 LFKYICE 173
             ::::||
  Rat   272 -YRWVCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/129 (24%)
Asgr1NP_036635.1 Lectin_N 4..143 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 153..278 CDD:153060 33/137 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.