DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-89

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:171 Identity:33/171 - (19%)
Similarity:55/171 - (32%) Gaps:52/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTVDMTPFIKINESY---------YVFGQTKVNWYVAYENCRRL----QSELVTFETAEEFDAIA 87
            |::..|.|....:|:         |...:.::....|:..|:::    .:.::..|...|.|.|:
 Worm    21 LSIPPTTFPNCPKSWHHDEPGRTCYHLARRRMRLTEAHSYCQKMIADGSAHVLRVECGGENDFIS 85

  Fly    88 AFLNARGDRSEHWTSGN----------DLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIH 142
            ..:  :|...:.|....          .|...|..|.:.|.::|....||     |..|.|.   
 Worm    86 GLV--KGHSEKVWIDARARFDIVDGAAGLFGPGFVYRWPNGKIVRYSNWA-----NGNGLEE--- 140

  Fly   143 LGYIYGYSTEFQLNDRPCHN----------HASSLFKYICE 173
                .|.|     |...|.|          :.||....|||
 Worm   141 ----VGSS-----NSNKCINIKSDGHWMNANCSSTAAVICE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/156 (18%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480 28/159 (18%)
CLECT 183..321 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.