DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Klrh1

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001014997.1 Gene:Klrh1 / 232415 MGIID:2685002 Length:223 Species:Mus musculus


Alignment Length:132 Identity:31/132 - (23%)
Similarity:48/132 - (36%) Gaps:37/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY-W 114
            |.|.:.:..|..:..:|:.|.|.|...::.||.:.|.:.:|     ..:|..   |.|.|:.: |
Mouse   112 YFFSEEEKTWDESEASCKVLGSLLAKIDSREEQNFIQSQVN-----YSYWVG---LHKKGSQFQW 168

  Fly   115 F--------SNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYI 171
            .        |:....|....|..:         |       ||.....||..|||.:    |.||
Mouse   169 VHHKDAKLSSDLDFHTATHVADAE---------C-------GYIKPKNLNVAPCHRY----FYYI 213

  Fly   172 CE 173
            |:
Mouse   214 CK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/130 (23%)
Klrh1NP_001014997.1 Ly49 31..114 CDD:285577 1/1 (100%)
CLECT_NK_receptors_like 100..216 CDD:153063 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.