DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Mgl2

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:173 Identity:44/173 - (25%)
Similarity:61/173 - (35%) Gaps:58/173 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEE----FDAIAAFLNARGDRSEH----WTSGND 105
            |.|.|.:::.:|..|.:.||...|.||...:.||    .:.:|..|:..|...::    |..|.|
Mouse   200 SCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTD 264

  Fly   106 LGK--------------TGTHYWFS---------------------NAQLVTIKRWAPKQPDN-- 133
            ..|              .|..|.||                     :||....:.|.|.||||  
Mouse   265 FDKGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSGNMADGQIWSAQFFIFRNWRPLQPDNWH 329

  Fly   134 ---AGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
               .||.|.|.|..|      :.:.||..|..|    :.:|||
Mouse   330 GHMLGGGEDCAHFSY------DGRWNDDVCQRH----YHWICE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 42/171 (25%)
Mgl2XP_006532975.1 Lectin_N 39..180 CDD:367741
CLECT_DC-SIGN_like 190..363 CDD:153060 44/173 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.