DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Reg3g

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_035390.1 Gene:Reg3g / 19695 MGIID:109406 Length:174 Species:Mus musculus


Alignment Length:133 Identity:32/133 - (24%)
Similarity:57/133 - (42%) Gaps:22/133 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYVFGQTKVNWYVAYENC-RRLQSELVTFETAEEFDAIAAFLNARGDRSEH-W------TSGNDL 106
            |.:|..:| |||.|...| :|....||:..:..|...:::.:.:.|:..:: |      |.|.:.
Mouse    52 YALFSVSK-NWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEP 115

  Fly   107 GKTGTHYW-FSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKY 170
            .:.|   | :|||.::....|......::|  .||..|....|:     |..|  .|:.:....|
Mouse   116 NRGG---WEWSNADVMNYINWETNPSSSSG--NHCGTLSRASGF-----LKWR--ENYCNLELPY 168

  Fly   171 ICE 173
            :|:
Mouse   169 VCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/131 (24%)
Reg3gNP_035390.1 CLECT_REG-1_like 40..172 CDD:153064 32/133 (24%)
EPN. /evidence=ECO:0000250 114..116 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11565
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.