powered by:
Protein Alignment lectin-37Da and clec-242
DIOPT Version :9
Sequence 1: | NP_001014489.1 |
Gene: | lectin-37Da / 3346222 |
FlyBaseID: | FBgn0053532 |
Length: | 186 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_507369.2 |
Gene: | clec-242 / 190531 |
WormBaseID: | WBGene00013471 |
Length: | 209 |
Species: | Caenorhabditis elegans |
Alignment Length: | 53 |
Identity: | 15/53 - (28%) |
Similarity: | 26/53 - (49%) |
Gaps: | 8/53 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 GYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWY--VAYENCRRL 70
|.|.:...:.:|.|.||.::: ||:...|::.|.. || |..:|..:|
Worm 139 GTDGFNWRLSDGEPNNLFLNV--FIQYENSWFFFQY----WYRQVILQNTLKL 185
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-37Da | NP_001014489.1 |
CLECT |
49..173 |
CDD:153057 |
7/24 (29%) |
clec-242 | NP_507369.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.