DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-4

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_496688.1 Gene:clec-4 / 189654 WormBaseID:WBGene00012583 Length:425 Species:Caenorhabditis elegans


Alignment Length:194 Identity:44/194 - (22%)
Similarity:68/194 - (35%) Gaps:69/194 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LTVDMTPFIKINESYY----VFGQTKVN------------WYVAYENCRRLQSELVTFETAEEFD 84
            |.|.:...:.|:|:.|    ..|.|.:|            ...|.:.|:...:.|||.:.:.:..
 Worm     8 LLVSLLLLLTISEASYPPVCTSGFTLINGKCLRIFVDVSTHTAAEKTCKGYGATLVTVKNSIDNR 72

  Fly    85 AIAAFLNARGDRSEHWTSG-----NDLGK------TGTHYWFSNAQLVTIKRWAPKQPDNAGGRE 138
            |||.|   .|:.:..:..|     :|:.|      ||:...:.|        :|...|..|.|  
 Worm    73 AIADF---TGNNANLFWMGLYCFDSDVSKCLWDDATGSAEVYDN--------FAAGFPHIALG-- 124

  Fly   139 HCIHL---GYIYGYSTEFQLNDR-------------PC-----------HNHASSLFK--YICE 173
            :|::.   |.:.|.......|||             ||           ||.||:..|  .|||
 Worm   125 NCVYYSVQGALAGMWLSSDCNDRRSFICELPASHADPCPYNYNGFCYTFHNTASTYTKGQKICE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 38/179 (21%)
clec-4NP_496688.1 CLECT 27..153 CDD:214480 29/138 (21%)
CLECT 162..283 CDD:214480 9/27 (33%)
CUB 309..415 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.