Sequence 1: | NP_001014489.1 | Gene: | lectin-37Da / 3346222 | FlyBaseID: | FBgn0053532 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507233.2 | Gene: | clec-38 / 188900 | WormBaseID: | WBGene00012025 | Length: | 382 | Species: | Caenorhabditis elegans |
Alignment Length: | 231 | Identity: | 45/231 - (19%) |
---|---|---|---|
Similarity: | 71/231 - (30%) | Gaps: | 76/231 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLKTLVQLFLVVA---------GFAPGFGYDKYTT----------------HIQ-------NGNP 33
Fly 34 YNLTVDMTPFIK--INESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI------AAFL 90
Fly 91 NARGDRSEH--------------WTS--GNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREH 139
Fly 140 CIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAP 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-37Da | NP_001014489.1 | CLECT | 49..173 | CDD:153057 | 24/145 (17%) |
clec-38 | NP_507233.2 | CLECT | 122..250 | CDD:214480 | 24/147 (16%) |
CLECT | 264..377 | CDD:214480 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |