DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-38

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_507233.2 Gene:clec-38 / 188900 WormBaseID:WBGene00012025 Length:382 Species:Caenorhabditis elegans


Alignment Length:231 Identity:45/231 - (19%)
Similarity:71/231 - (30%) Gaps:76/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKTLVQLFLVVA---------GFAPGFGYDKYTT----------------HIQ-------NGNP 33
            :|..|..:||::|         |.|.......|||                .:|       .|.|
 Worm    42 LLGILNLIFLIIAIVFAILFFVGSADCAQLPDYTTSPASQLTTSAISSRTSEVQTNAITTTQGTP 106

  Fly    34 YNLTVDMTPFIK--INESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI------AAFL 90
            .|.|...||...  |..|.:....||         |.:|.|   :.:...|.|:|      :...
 Worm   107 SNKTSTTTPSTSKVICASGFTLVGTK---------CGKLVS---SNQPRTEADSICKGYGGSTLF 159

  Fly    91 NARGDRSEH--------------WTS--GNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREH 139
            :.|.::...              ||.  .|...:|...:...:........:|...|:...|  :
 Worm   160 SVRNEQETRDMLDFVKDSNIDFLWTGLVCNQTARTSCIWDVKSGTTADYNNFADGFPNVVYG--Y 222

  Fly   140 CIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAP 175
            ||:  :|...::..|.....|    |.|..::||.|
 Worm   223 CIY--FIVTGNSAGQWGSEQC----SQLMNFVCELP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 24/145 (17%)
clec-38NP_507233.2 CLECT 122..250 CDD:214480 24/147 (16%)
CLECT 264..377 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.