Sequence 1: | NP_001014489.1 | Gene: | lectin-37Da / 3346222 | FlyBaseID: | FBgn0053532 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494002.2 | Gene: | clec-21 / 188250 | WormBaseID: | WBGene00020327 | Length: | 421 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 41/195 - (21%) |
---|---|---|---|
Similarity: | 67/195 - (34%) | Gaps: | 65/195 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLKTLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYE 65
Fly 66 NCRRLQSELVTFETAEE-FDAIA---------------AFLNARGDRSE-HWTSGNDLGKTGTHY 113
Fly 114 WFSNAQLVTIKRWAPKQPDNAGGRE-HCIHLGYIYGY--STEFQLNDRPCHNHASSLFKYICEAP 175
Fly 176 175 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-37Da | NP_001014489.1 | CLECT | 49..173 | CDD:153057 | 26/143 (18%) |
clec-21 | NP_494002.2 | CLECT | 23..152 | CDD:214480 | 32/167 (19%) |
CLECT | 165..284 | CDD:214480 | |||
CUB | 307..408 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |