DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-149

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:153 Identity:34/153 - (22%)
Similarity:60/153 - (39%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDA 85
            |::.||........:|.....|.|..|:..|.|.|.:.:||.|.|.|....:.|.:..:..|...
 Worm   167 YERITTKDIVEIKRHLDYLQAPRITNNDLEYFFIQREESWYTASEKCIGYGAHLASIHSRLELGF 231

  Fly    86 IAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYS 150
            :...:..   ....|...||:.|... :..|:...|...:|..|||||....|:|:.:.:...::
 Worm   232 VQRLVPV---NQTAWIGVNDIQKENV-FRNSDGTPVDFYKWGKKQPDNQEHNENCVEVDHSGQWT 292

  Fly   151 TEFQLNDRPCHNHASSLFKYICE 173
            .:..:..||          ::|:
 Worm   293 DKLCIITRP----------FVCK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/123 (21%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.