DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and F52E1.2

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_505170.2 Gene:F52E1.2 / 186111 WormBaseID:WBGene00018692 Length:204 Species:Caenorhabditis elegans


Alignment Length:142 Identity:40/142 - (28%)
Similarity:57/142 - (40%) Gaps:29/142 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 INESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAI-AAF-LNARGDRS-EHWTSGNDLG 107
            :|...|......|.:..|...|....:||||.::.:|.||: .|| .||..|.: |.|.....| 
 Worm    73 LNSKCYKKFDAAVTYAGATSACAAQGAELVTIDSFDENDALRKAFDTNALVDETKETWIGLKSL- 136

  Fly   108 KTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHL--------GYIY---GYSTEFQLNDRPCH 161
             :|...| ::....|...|||.||.:.|   .|:.:        .|.|   |:.|      ..|.
 Worm   137 -SGAWQW-ADGSSATYTNWAPSQPSSNG---LCVQMITDSLSNATYKYQRGGWKT------YGCG 190

  Fly   162 NHASSLFKYICE 173
            ..::|   ||||
 Worm   191 KTSAS---YICE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 37/137 (27%)
F52E1.2NP_505170.2 CLECT 66..199 CDD:214480 38/140 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.