DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Reg3b

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_035166.1 Gene:Reg3b / 18489 MGIID:97478 Length:175 Species:Mus musculus


Alignment Length:132 Identity:30/132 - (22%)
Similarity:51/132 - (38%) Gaps:15/132 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SY-YVFGQTKVNWYVAYENC-RRLQSELVTFETAEEFDAIAAFLNARGDRSEH-WTSGND--LG- 107
            || |...|....|:.|...| :|....||:...:.|...:::.:...|:..:: |...:|  || 
Mouse    49 SYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGA 113

  Fly   108 -KTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYI 171
             ..|..:.:||..::....| .:.|..|..|..|..|....|:   .:..|..|    .....|:
Mouse   114 EPNGGGWEWSNNDVMNYFNW-ERNPSTALDRAFCGSLSRASGF---LKWRDMTC----EVKLPYV 170

  Fly   172 CE 173
            |:
Mouse   171 CK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 29/130 (22%)
Reg3bNP_035166.1 CLECT_REG-1_like 40..173 CDD:153064 30/132 (23%)
EPN. /evidence=ECO:0000250 114..116 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11565
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.