DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and clec-198

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_503091.3 Gene:clec-198 / 183598 WormBaseID:WBGene00008203 Length:499 Species:Caenorhabditis elegans


Alignment Length:131 Identity:27/131 - (20%)
Similarity:41/131 - (31%) Gaps:43/131 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 INESYYVFGQTKVNWYVAYENC--RRLQSELVTFETAEEFDAIAAFLNARG-------------- 94
            :|...|........||.|.:.|  :|..|.|.:..:..|...|||...:.|              
 Worm    94 VNGMCYKIATADTTWYAAEDWCYSQRYGSHLTSVHSEAEAQWIAATYVSTGWFPYMDNWLGLRRS 158

  Fly    95 -DRSEH-WTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHL----------GYIY 147
             |.|.: ||.|..:    .:.|           |.|..|.:....:.|:.:          ||:.
 Worm   159 CDNSTYIWTDGTPV----DYLW-----------WQPGYPGSGDPEKSCVTIWVTSLLKLNPGYVQ 208

  Fly   148 G 148
            |
 Worm   209 G 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/128 (20%)
clec-198NP_503091.3 CLECT 85..198 CDD:214480 24/118 (20%)
CLECT 371..497 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1 Normalized mean entropy S7305
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.