Sequence 1: | NP_001014489.1 | Gene: | lectin-37Da / 3346222 | FlyBaseID: | FBgn0053532 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503089.2 | Gene: | C49C3.11 / 178520 | WormBaseID: | WBGene00008201 | Length: | 240 | Species: | Caenorhabditis elegans |
Alignment Length: | 242 | Identity: | 50/242 - (20%) |
---|---|---|---|
Similarity: | 69/242 - (28%) | Gaps: | 103/242 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRL 70
Fly 71 QSELVTFETAEEF-----------------------DAIAAF----------------------- 89
Fly 90 --LNARGDRSE---HWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQP-DNAGG--REHCIHLGY- 145
Fly 146 ---------IYGYSTEFQLNDRPCHNHAS-SLFK---YICEAPKQET 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-37Da | NP_001014489.1 | CLECT | 49..173 | CDD:153057 | 35/191 (18%) |
C49C3.11 | NP_503089.2 | CLECT | 50..210 | CDD:153057 | 35/181 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |