DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec10a

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001191181.1 Gene:Clec10a / 17312 MGIID:96975 Length:305 Species:Mus musculus


Alignment Length:131 Identity:40/131 - (30%)
Similarity:52/131 - (39%) Gaps:22/131 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY 113
            |.|.|.:::.:|..|.:.||...|.||...:.||.:    ||..|......|....|  :.|...
Mouse   184 SCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQN----FLQNRLANVVSWIGLTD--QNGPWR 242

  Fly   114 WFSNAQLVT-IKRWAPKQPDN-----AGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYIC 172
            |........ .|.|||.||||     .||.|.|.|:      :|....||..|..    .|::||
Mouse   243 WVDGTDFEKGFKNWAPLQPDNWFGHGLGGGEDCAHI------TTGGPWNDDVCQR----TFRWIC 297

  Fly   173 E 173
            |
Mouse   298 E 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 38/129 (29%)
Clec10aNP_001191181.1 Lectin_N 14..164 CDD:281887
CLECT_DC-SIGN_like 174..299 CDD:153060 40/131 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.