DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Reg3a

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001139318.1 Gene:Reg3a / 171162 RGDID:621401 Length:174 Species:Rattus norvegicus


Alignment Length:136 Identity:28/136 - (20%)
Similarity:55/136 - (40%) Gaps:15/136 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KINESY-YVFGQTKVNWYVAYENC-RRLQSELVTFETAEEFDAIAAFLNAR-GDRSEHWTSGND- 105
            |...|| |....|..:|:.|...| :|....||:..:..|...:::.:..| .:..:.|...:| 
  Rat    44 KAYRSYCYTLVTTLKSWFQADLACQKRPSGHLVSILSGGEASFVSSLVTGRVNNNQDIWIGLHDP 108

  Fly   106 -LGK--TGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSL 167
             :|:  .|..:.:||:.::....| ...|.:...|.:|   |.:...|...:..|    :|....
  Rat   109 TMGQQPNGGGWEWSNSDVLNYLNW-DGDPSSTVNRGNC---GSLTATSEFLKWGD----HHCDVE 165

  Fly   168 FKYICE 173
            ..::|:
  Rat   166 LPFVCK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/130 (20%)
Reg3aNP_001139318.1 CLECT 39..172 CDD:295302 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I11353
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.