DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Cd209e

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_570975.1 Gene:Cd209e / 170780 MGIID:2157948 Length:208 Species:Mus musculus


Alignment Length:153 Identity:40/153 - (26%)
Similarity:67/153 - (43%) Gaps:30/153 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEH-WTS 102
            |.|.|   |.:.|.|.:::.:|:.:...|:.:.::||..::.||    .:||.....::.: |..
Mouse    80 DWTFF---NGNCYFFSKSQRDWHDSMTACKEMGAQLVIIKSHEE----QSFLQQTSKKNSYTWMG 137

  Fly   103 GNDLGKTGTHYWFSNAQLVTI--KRWAPKQPDNAGGREHCIHLGYIYGYSTEFQ---LNDRPCHN 162
            .:||.|.|..||...:.|...  |.|...||:|.||:: |:          ||:   .||..|..
Mouse   138 LSDLNKEGEWYWLDGSPLSDSFEKYWKKGQPNNVGGQD-CV----------EFRDNGWNDAKCEQ 191

  Fly   163 HASSLFKYICEAPKQETVSIVVW 185
            ...    :||:  |..|..:..|
Mouse   192 RKF----WICK--KIATTCLSKW 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 32/129 (25%)
Cd209eNP_570975.1 CLECT_DC-SIGN_like 77..199 CDD:153060 37/142 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.