DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec4f

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:156 Identity:41/156 - (26%)
Similarity:61/156 - (39%) Gaps:25/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 HIQNGNPYN--LTVDMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAF 89
            |.|.....|  |.:.|..:...|..:|.|.:.|.:|:.|...|....:.|.:..:.||    .||
  Rat   398 HTQGQKTQNQVLQLIMQDWKYFNGKFYYFSRDKKSWHEAENFCVSQGAHLASVTSQEE----QAF 458

  Fly    90 LNARGDRSEHWTSGNDLGKTGTHYWFSNA--QLVTIKR-WAPKQPDN----AGGREHCIHLGYIY 147
            |....:..:||....|.|..|...|....  ..|..:| |...||||    .|.||.|:||..::
  Rat   459 LVQITNAVDHWIGLTDQGTEGNWRWVDGTPFDYVQSRRFWRKGQPDNWRHGNGEREDCVHLQRMW 523

  Fly   148 GYSTEFQLNDRPCHNHASSLFKYICE 173
                    ||..|    .:.:.::|:
  Rat   524 --------NDMAC----GTAYNWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 34/130 (26%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008
CLECT_DC-SIGN_like 414..538 CDD:153060 36/140 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.