DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and LOC110438686

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327448.1 Gene:LOC110438686 / 110438686 -ID:- Length:87 Species:Danio rerio


Alignment Length:81 Identity:15/81 - (18%)
Similarity:34/81 - (41%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 MTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGN 104
            ::|:..::|  :.......||..:.:.||....:|:..::.|:...:.:|:..: .:...|....
Zfish     7 LSPWCALDE--FFSSMDSKNWSESRQYCRDRGEDLLIIKSEEKQRRVTSFITEK-VKMPVWLGLT 68

  Fly   105 DLGKTGTHYWFSNAQL 120
            |....|...|..|:.|
Zfish    69 DAEIEGNMIWVDNSPL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 13/72 (18%)
LOC110438686XP_021327448.1 CLECT 16..>86 CDD:321932 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.