DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:180 Identity:39/180 - (21%)
Similarity:62/180 - (34%) Gaps:48/180 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DKYTTHIQNGNPY-----NLTVDMTPFIK----------INESYYVFGQTKVNWYVAYENCRRLQ 71
            :|.||..:..|..     ||..|....||          ...|:|.....:.:|..:..:|:...
Zfish   123 NKITTFTKARNEILKKNANLLKDKDQLIKQLQVFGQEAYYQSSFYYLSSERKSWTESRRDCKDRG 187

  Fly    72 SELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPK----QPD 132
            ::|:.....:|.|    |:......:|.|....|..|.|...|...:.| |.:.||..    :| 
Zfish   188 ADLIIINNKQEQD----FIMKITSNNEFWIGLTDSDKEGIWKWVDGSNL-TSRFWASSGSITEP- 246

  Fly   133 NAGGREHC--IHL-------GYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            |....|:|  .||       |::          |..|    ...:::|||
Zfish   247 NGRKTENCAVTHLKKHPELIGWL----------DVAC----DGAYQWICE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/136 (21%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 30/142 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.