powered by:
Protein Alignment lectin-37Da and LOC101734545
DIOPT Version :9
Sequence 1: | NP_001014489.1 |
Gene: | lectin-37Da / 3346222 |
FlyBaseID: | FBgn0053532 |
Length: | 186 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031750858.1 |
Gene: | LOC101734545 / 101734545 |
-ID: | - |
Length: | 471 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 19/68 - (27%) |
Similarity: | 28/68 - (41%) |
Gaps: | 10/68 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 WYVAYENCRRLQSEL------VTFETAEEFDAIAAFLNARGDRSEHWTSGNDL---GKTGTHYWF 115
:|.:.|:..|||||. ......||.|.|...:.|:..|| :|.....: |:|....|.
Frog 324 YYFSSESQYRLQSETACRSSGAVLAKLEESDDILKKMIAKSSRS-YWIGLKKVEHQGQTNLFRWS 387
Fly 116 SNA 118
.|:
Frog 388 DNS 390
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-37Da | NP_001014489.1 |
CLECT |
49..173 |
CDD:153057 |
19/68 (28%) |
LOC101734545 | XP_031750858.1 |
Smc |
<87..>306 |
CDD:224117 |
|
CLECT |
312..424 |
CDD:413318 |
19/68 (28%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.