DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and Clec3b

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_003750657.1 Gene:Clec3b / 100912012 RGDID:1311031 Length:202 Species:Rattus norvegicus


Alignment Length:138 Identity:39/138 - (28%)
Similarity:59/138 - (42%) Gaps:24/138 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KIN-ESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNAR---GDRSEHWTSGND 105
            |:| :....|.|.| .::.|.|:|......|.|.::..|.:|:  |..||   |..:|.|...||
  Rat    76 KVNLKCLLAFTQPK-TFHEASEDCISQGGTLGTPQSELENEAL--FEYARQSVGSEAELWLGLND 137

  Fly   106 LGKTGTHYWFSNAQLVTIKRWAPK---QPDNAGGR-EHCIHL-GYIYGYSTEFQLNDRPCHNHAS 165
            :...|.....:..:| ..|.|..:   |||  ||: |:|..| |...|     :..|:.|.:.  
  Rat   138 MASEGAWVDMTGGRL-AYKNWETEITTQPD--GGKAENCAALSGAANG-----KWFDKRCRDQ-- 192

  Fly   166 SLFKYICE 173
              ..|||:
  Rat   193 --LPYICQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 36/131 (27%)
Clec3bXP_003750657.1 CLECT_tetranectin_like 71..199 CDD:153066 39/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.