DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and LOC100537194

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017211404.1 Gene:LOC100537194 / 100537194 -ID:- Length:306 Species:Danio rerio


Alignment Length:128 Identity:30/128 - (23%)
Similarity:51/128 - (39%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QTKVNWYVAYEN--------CRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGT 111
            ::|..|:...|.        ||...:|||..::..:...|::.:     :.:.|...:|....||
Zfish   190 RSKQGWFFTEEKSWSESRQFCRNRGAELVIIKSEVKQRVISSLV-----KEDVWIGLSDTETEGT 249

  Fly   112 HYWFSNAQLVTIKRWAPKQPDNAGGR-EHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            ..|..|:.: ....||..:|:|...: |.|:.:....|....:  ||..|    |...|.|||
Zfish   250 MKWVDNSPM-NQGFWARGEPNNYRSQDEDCVEVRISQGIPNNW--NDLRC----SDRRKGICE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/126 (22%)
LOC100537194XP_017211404.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.