DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and LOC100487836

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017948017.1 Gene:LOC100487836 / 100487836 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:134 Identity:34/134 - (25%)
Similarity:51/134 - (38%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAF---------LNARGDRSEHWTSGNDL 106
            |.|.:...:|..:.:.|::|.|:|:.|....|.||:..:         |....|:..:|..|..|
 Frog   273 YFFSKEPKSWADSRQQCQKLGSDLLIFTDQAEVDALYQYMQNKRFWIGLQRNKDQKWNWVDGKAL 337

  Fly   107 GKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYI 171
                           |..||...:|:|||..|||       |.:.....||..|    ..:..:|
 Frog   338 ---------------TFNRWGTGEPNNAGSGEHC-------GETLSRYWNDLKC----GDIIDFI 376

  Fly   172 CEAP 175
            ||.|
 Frog   377 CEGP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 31/130 (24%)
LOC100487836XP_017948017.1 EnvC 165..>257 CDD:227278
CLECT_DC-SIGN_like 261..378 CDD:153060 31/130 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I10459
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.