DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and reg4

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_004916045.2 Gene:reg4 / 100485485 XenbaseID:XB-GENE-952114 Length:161 Species:Xenopus tropicalis


Alignment Length:128 Identity:33/128 - (25%)
Similarity:55/128 - (42%) Gaps:18/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNW------YVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKT 109
            |.:.:.|::|      .|:|.:...|.|.|   :.||. |.||:.::|.....:.|...:|..:.
 Frog    42 YGYFRFKLSWSEAEFECVSYGHGAHLASIL---DNAEA-DIIASHVSAYQVNGDVWIGLHDPEQN 102

  Fly   110 GTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQ-LNDRPCH--NHASSLFK 169
            ....| ::..:...:.|...:|:|....|:|..|    ...|.|: .||.||:  ||....||
 Frog   103 RRWKW-NDGSMYNYRNWKNGEPNNVNNEEYCGEL----AVETRFEKWNDAPCNIQNHFVCKFK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 33/128 (26%)
reg4XP_004916045.2 CLECT_REG-1_like 30..159 CDD:153064 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.