DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and LOC100363064

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:127 Identity:31/127 - (24%)
Similarity:54/127 - (42%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHY 113
            |.|:|.:|..:|..:..:|:.|.:.||...:..| .....:.|.|.:: ..|...:|..:.|:..
  Rat   161 SCYLFSRTLASWGASASSCKDLGAHLVIINSVAE-QRFMKYWNVRKNQ-RSWIGLSDHLREGSWQ 223

  Fly   114 WFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAP 175
            |..::.| ....|...:|:| .|.|.|:.|     :..|:  ||..|.....    ::||.|
  Rat   224 WVDHSPL-KFSFWKEGEPNN-DGDEDCVEL-----FMDEW--NDNTCTQQNF----WVCEQP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/123 (23%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 28/123 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.160

Return to query results.
Submit another query.