DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and cd209

DIOPT Version :10

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:134 Identity:31/134 - (23%)
Similarity:47/134 - (35%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAF---------LNARGDRSEHWTSGN 104
            |:|.....:.||..:...||...::|:.....||.|.:...         |....||.: |..|.
Zfish   229 SFYFISSEERNWTESRRYCRDKGADLIIINNREEQDHVKKMSGGFTVWIGLTDSDDRWK-WIDGT 292

  Fly   105 DLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFK 169
            :: .||..:|...            :|:..|| |:|:       .|......|.||...    |.
Zfish   293 NM-TTGFRFWNHG------------EPNGQGG-ENCV-------TSRSSGWADYPCFYP----FP 332

  Fly   170 YICE 173
            :|||
Zfish   333 WICE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 29/132 (22%)
cd209NP_001186302.2 Mplasa_alph_rch <121..>199 CDD:275316
CLECT_DC-SIGN_like 220..337 CDD:153060 31/134 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.