DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and cd209

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:134 Identity:31/134 - (23%)
Similarity:47/134 - (35%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAF---------LNARGDRSEHWTSGN 104
            |:|.....:.||..:...||...::|:.....||.|.:...         |....||.: |..|.
Zfish   229 SFYFISSEERNWTESRRYCRDKGADLIIINNREEQDHVKKMSGGFTVWIGLTDSDDRWK-WIDGT 292

  Fly   105 DLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFK 169
            :: .||..:|...            :|:..|| |:|:       .|......|.||...    |.
Zfish   293 NM-TTGFRFWNHG------------EPNGQGG-ENCV-------TSRSSGWADYPCFYP----FP 332

  Fly   170 YICE 173
            :|||
Zfish   333 WICE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 29/132 (22%)
cd209NP_001186302.2 DivIC 94..183 CDD:299713
CLECT_DC-SIGN_like 220..337 CDD:153060 31/134 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.