DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-232p21.6

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327532.1 Gene:si:ch211-232p21.6 / 100334411 ZFINID:ZDB-GENE-131121-178 Length:149 Species:Danio rerio


Alignment Length:122 Identity:32/122 - (26%)
Similarity:48/122 - (39%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWF 115
            |||....::|..:...|:.|..:||..::.||.:.::..:|  |....||...:|....|...|.
Zfish    30 YVFSTDVMDWSSSRRRCQDLGGDLVVIDSTEEQEFLSKKVN--GVHDFHWIGLSDSQMEGVWLWV 92

  Fly   116 SNAQLVTIKRWAPKQPD-----NAGGREHCIHL-GYIYGYSTEFQLNDRPCHNHASS 166
            .|..|.....| ...||     |....|.|:.| ...:|..:..:...|.|..|.||
Zfish    93 DNTTLNNDTSW-DSPPDDWKAENPLDGEDCVILKDRKWGDVSCLRKEKRICEIHCSS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 32/122 (26%)
si:ch211-232p21.6XP_021327532.1 CLECT_DC-SIGN_like 26..143 CDD:153060 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.160

Return to query results.
Submit another query.