DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-193e13.5

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_009303416.1 Gene:si:ch211-193e13.5 / 100331104 ZFINID:ZDB-GENE-081104-158 Length:257 Species:Danio rerio


Alignment Length:139 Identity:30/139 - (21%)
Similarity:50/139 - (35%) Gaps:31/139 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DMTPFIKINESYYVFGQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSG 103
            |...:|..|.|:|.....|.:|..:..:|::..::|...::.||...:...  |..|  .:|   
Zfish   138 DNFKWIYYNFSFYYISSEKKSWEDSRRDCQQRNADLAIIKSPEEKKCLLKV--AASD--FYW--- 195

  Fly   104 NDLGKTGTHY----WFSNAQLVTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHA 164
              :|.|..||    |...:.|..   |...:           |..|.....|.....::.|.|  
Zfish   196 --IGLTKKHYRQWNWVDGSLLTD---WYFNR-----------HSHYYCAMITSAGWREKSCAN-- 242

  Fly   165 SSLFKYICE 173
              |.|:||:
Zfish   243 --LNKWICK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 26/127 (20%)
si:ch211-193e13.5XP_009303416.1 DASH_Dad1 69..>106 CDD:285812
CLECT_NK_receptors_like 141..250 CDD:153063 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.