DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-160b11.4

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327879.1 Gene:si:ch211-160b11.4 / 100150558 ZFINID:ZDB-GENE-081104-142 Length:315 Species:Danio rerio


Alignment Length:160 Identity:37/160 - (23%)
Similarity:59/160 - (36%) Gaps:37/160 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VDMTPFIK----------------INESYYVFGQTKVNWYVAYENCRR------LQSELVTFETA 80
            |||.|..|                :..:.|.|...|:|...|...|::      |.|...:|..|
Zfish   170 VDMNPGRKQRMALQKGRRRCRGFTVQHTCYEFFTRKLNASDAELQCQKGCPNGHLASVTSSFIRA 234

  Fly    81 EEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGREHCIHLGY 145
            |.::    .::....||:.|..|..:..|.|..|. :.:..|...:...:|:|.||.|.||.:.|
Zfish   235 EIYN----LMDRYSSRSDTWLGGRRIIGTNTFTWL-DGEPWTYNGFFSGEPNNLGGNEDCIEILY 294

  Fly   146 IYGYSTEFQLNDRPCHNHASSLFKYICEAP 175
            ..|::.......||          ::|..|
Zfish   295 RVGFNDVACFLTRP----------FVCSCP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/129 (23%)
si:ch211-160b11.4XP_021327879.1 CLECT 198..311 CDD:153057 30/127 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.