DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and hbl4

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001108197.1 Gene:hbl4 / 100137128 ZFINID:ZDB-GENE-070912-287 Length:245 Species:Danio rerio


Alignment Length:179 Identity:41/179 - (22%)
Similarity:66/179 - (36%) Gaps:33/179 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 APGFGYDKYT-----THIQNGNPYNLTVDM----------------TPFIKINESYYVFGQTKVN 59
            |||...|:.:     |.:||.....|..|:                ..|.|:.:.|||......|
Zfish    78 APGHKGDRGSPGLSGTDVQNALVTQLRSDVKHLTDRLTVIDKVLGFRMFKKVGQKYYVSDGLVGN 142

  Fly    60 WYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIK 124
            :..|.:.|....:::|...:.:|...:.:...|......| ....|..|.| |:...:.|.:|..
Zfish   143 FETAQKFCSDAGAKIVLPRSEDENKVLISLQEALESTYVH-VGATDAKKEG-HFVDLSDQPLTFT 205

  Fly   125 RWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            .|..|:|::..|.|.|..:     |.|.. .||..|    :|.:..:||
Zfish   206 NWKEKEPNDYNGAEDCTAV-----YKTGV-WNDINC----NSKWHVVCE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 28/123 (23%)
hbl4NP_001108197.1 Collagen 33..>92 CDD:189968 4/13 (31%)
CLECT_collectin_like 131..245 CDD:153061 30/126 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.