DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Da and si:ch211-214k5.3

DIOPT Version :9

Sequence 1:NP_001014489.1 Gene:lectin-37Da / 3346222 FlyBaseID:FBgn0053532 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_009303575.2 Gene:si:ch211-214k5.3 / 100034611 ZFINID:ZDB-GENE-041210-206 Length:291 Species:Danio rerio


Alignment Length:186 Identity:40/186 - (21%)
Similarity:66/186 - (35%) Gaps:50/186 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DKYTTHIQNGNP--YNLTVDMTPFIKINE-------------------------------SYYVF 53
            |:...:|..||.  .|||.:....:..|:                               |:|..
Zfish   118 DQLLININAGNAQNQNLTKEKNELLSKNDDLIIQNVQLQQVENNLQECRNKLDGWFNYQSSFYFI 182

  Fly    54 GQTKVNWYVAYENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNA 118
            ...|.||..:..|||...::|:.....||.|.:...  :.||  ..|...:|..:.|:..|..:.
Zfish   183 SSEKKNWSESTRNCRDRGADLIIINNKEEQDFVKKI--SGGD--VVWIGLSDSDEEGSWKWVDDP 243

  Fly   119 QLVT-IKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICE 173
            .:.: .:.|...:|:...| |:|       ..|......|.||:|:    |::|||
Zfish   244 SMTSGFRFWGTFEPNGKRG-ENC-------AVSRSSGWADYPCNNY----FQWICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DaNP_001014489.1 CLECT 49..173 CDD:153057 30/124 (24%)
si:ch211-214k5.3XP_009303575.2 ATPgrasp_Ter 113..>187 CDD:330691 10/68 (15%)
CLECT_DC-SIGN_like 170..288 CDD:153060 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.