DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and asgr1c.1

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_001339584.3 Gene:asgr1c.1 / 799199 ZFINID:ZDB-GENE-060526-151 Length:521 Species:Danio rerio


Alignment Length:130 Identity:36/130 - (27%)
Similarity:61/130 - (46%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YYISLAKTNWFEASNHCRQNGGFLLNL-ESREELELLSPHLHPAYSYWLSINDLGERGVYVSEAT 99
            ::.|..:.:|.||.::|:|....||.: :..||...|..|..|.: ||:.:.|         :.|
Zfish   405 FFFSETQVSWSEARDYCKQQEASLLKIQDDNEEWSFLKNHTIPKH-YWVGLTD---------QNT 459

  Fly   100 GL-----EAPF-LN---WSAGEPDN-------SSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
            |.     |.|: :|   |:.|:||:       ..|.| |..  :|.|. ::||:.|.:.:.|||:
Zfish   460 GQWRWVDETPYSINKERWNQGQPDDWKNHGLGEEGED-CGH--ISYTG-KLNDIHCSTKIRFICR 520

  Fly   149  148
            Zfish   521  520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 35/128 (27%)
asgr1c.1XP_001339584.3 CwlO1 114..>341 CDD:443091
CLECT_DC-SIGN_like 393..519 CDD:153060 34/127 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.