DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Clec4g

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:126 Identity:35/126 - (27%)
Similarity:53/126 - (42%) Gaps:27/126 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDL-------GERGV 93
            ||.|..:..|..|.::|...|..|:.:....|...||.|.. ...|||.:..:       |.|.|
Mouse   177 YYFSETQATWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTR-GRGYWLGLRAVRHLNKIQGYRWV 240

  Fly    94 YVSEATGLEAPFLNWSAGEPDNSSGYDRCV-----ELWLSTTSFQMNDLPCYSS-VAFICQ 148
                 .|....|.:|::|||::|.|::.|:     .||        ||.||.:. ..:||:
Mouse   241 -----DGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLW--------NDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 34/124 (27%)
Clec4gNP_083741.1 COG6 61..>163 CDD:473207
CLECT 165..289 CDD:470576 35/126 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.