DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Colec11

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:139 Identity:37/139 - (26%)
Similarity:65/139 - (46%) Gaps:8/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPA 78
            :|||..::..|.|   |...|.|.:...:..:.:|...|:..||.|...:......|::.:|..|
Mouse   142 NALPSPAAVAGVR---ETESKIYLLVKEEKRYADAQLSCQARGGTLSMPKDEAANGLMASYLAQA 203

  Fly    79 --YSYWLSINDLGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYS 141
              ...::.||||.:.|.:|.........|..|.:|||:|:...:.|||:   ..|...||:.|:.
Mouse   204 GLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDCVEM---VASGGWNDVACHI 265

  Fly   142 SVAFICQLN 150
            ::.|:|:.:
Mouse   266 TMYFMCEFD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 30/115 (26%)
Colec11NP_001300907.1 Collagen 48..99 CDD:460189
CLECT_collectin_like 158..273 CDD:153061 31/117 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.