DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and REG1A

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:120 Identity:30/120 - (25%)
Similarity:59/120 - (49%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YYISLAKTNWFEASNHCR-QNGGFLLNLESREE----LELLSPHLHPAYSYWLSINDLGERGVYV 95
            ||.:..:..|.:|..:|: .|.|.|:::.::.|    ..|:.......::.|:.::| .::....
Human    48 YYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHD-PKKNRRW 111

  Fly    96 SEATGLEAPFLNWSAGEPDN-SSGYDRCVELWLSTTSFQ-MNDLPCYSSVAFICQ 148
            ..::|....:.:|..|.|.: :.||  ||.| .|:|.|| ..|:||....:|:|:
Human   112 HWSSGSLVSYKSWGIGAPSSVNPGY--CVSL-TSSTGFQKWKDVPCEDKFSFVCK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 29/118 (25%)
REG1ANP_002900.2 CLECT 36..164 CDD:470576 30/120 (25%)

Return to query results.
Submit another query.