DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Clec7a

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_064392.2 Gene:Clec7a / 56644 MGIID:1861431 Length:244 Species:Mus musculus


Alignment Length:128 Identity:27/128 - (21%)
Similarity:53/128 - (41%) Gaps:24/128 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHL--HPAYSYWLSINDLGERGVY 94
            |:..|..|.:..:|:.:..||.|.|..||.:::.:|.|.:....  |...::|:.::.....|.:
Mouse   127 GKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPW 191

  Fly    95 VSEATGLEAPFLNWSAGEPDN---------SSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
            ..|         :.||..|::         .|....||  |:..:  ::.:..|.:|...||:
Mouse   192 FWE---------DGSAFFPNSFQVRNTAPQESLLHNCV--WIHGS--EVYNQICNTSSYSICE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 25/124 (20%)
Clec7aNP_064392.2 ITAM-like 15..18
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..113
CLECT_NK_receptors_like 119..242 CDD:153063 27/128 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.