DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and lectin-30A

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:137 Identity:44/137 - (32%)
Similarity:70/137 - (51%) Gaps:15/137 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LESSPLGNRYN----LEIGEKQYYISLA-KTNWFEASNHCRQNGGFLLNLESREEL-ELLSPHLH 76
            ||...:.:|.|    ..:|.:::||... |.|||.|||.|||.||.:..:...:|. |:.|  ..
  Fly    91 LEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFS--RA 153

  Fly    77 PAYSYWLSINDLGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYS 141
            ||..:|:.:|.:.:.|::.|..||...||..|...|..|.  :| ||.::    :.:|.:..|::
  Fly   154 PAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEERGNK--FD-CVNVY----NKEMYNENCFN 211

  Fly   142 SVAFICQ 148
            :..||||
  Fly   212 THLFICQ 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 37/115 (32%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 35/108 (32%)

Return to query results.
Submit another query.