DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and CLEC4A

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:140 Identity:30/140 - (21%)
Similarity:57/140 - (40%) Gaps:13/140 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WSALPLESSPLGNRYNLEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHP 77
            ||..|.......:..        |:||....:|.::...|.:....||.:.::||.:.:..:|..
Human   103 WSCCPKNWKSFSSNC--------YFISTESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQE 159

  Fly    78 AYSYWLSIND-LGERGVYVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWL--STTSFQMNDLPC 139
            ..:|::.::| .|:|.....:.|........|...||.:.:  :|||.|..  |...:..||:.|
Human   160 ESAYFVGLSDPEGQRHWQWVDQTPYNESSTFWHPREPSDPN--ERCVVLNFRKSPKRWGWNDVNC 222

  Fly   140 YSSVAFICQL 149
            ......:|::
Human   223 LGPQRSVCEM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 26/116 (22%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 28/135 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.