DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Acp29AB

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:123 Identity:39/123 - (31%)
Similarity:68/123 - (55%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EIGEKQYYI--SLAKTNWFEASNHCRQNGGFLLNLESREELE-LLSPHLHPAYSYWLSINDLGER 91
            ::|.:.::|  :|.:| ||||...||:..|.|.|::...||: :|:  |.|..|||:.|:.|.|.
  Fly   116 KVGSRHFHIEKNLMQT-WFEAYVTCRKMNGHLANIQDEMELDGILA--LAPNNSYWIDISKLVEN 177

  Fly    92 -GVYVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
             |.:||..||.|..|:.|.:.:  ::...::||.::....|:.    .|:...:|:||
  Fly   178 GGTFVSTLTGREPFFVKWKSNQ--DTKKKNQCVYIYAKEMSYD----ECFEKKSFVCQ 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 36/117 (31%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 36/116 (31%)

Return to query results.
Submit another query.