DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Colec10

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:122 Identity:38/122 - (31%)
Similarity:67/122 - (54%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPA--YSYWLSINDLGERG 92
            |..||.|||...:.|:.|:..|||..||.|...:......|::.::..:  :..::.:|||.:.|
  Rat   154 ETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEG 218

  Fly    93 VYV-SEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
            .|| ::.|.|: .:.||..|||.:..|::.|||:   .:|.:.||..|:.::.|:|:
  Rat   219 QYVFTDNTPLQ-NYSNWKEGEPSDPYGHEDCVEM---LSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 35/116 (30%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 37/119 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.