DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Colec10

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:122 Identity:38/122 - (31%)
Similarity:66/122 - (54%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 EIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPA--YSYWLSINDLGERG 92
            |..||.|||...:.|:.|:..|||..||.|...:......|::.::..:  :..::.:|||...|
Mouse   154 ETEEKFYYIVQEEKNYRESLTHCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREG 218

  Fly    93 VYV-SEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
            .|| ::.|.|: .:.||...||.:.||::.|||:   .:|.:.||..|:.::.|:|:
Mouse   219 QYVFTDNTPLQ-NYSNWKEEEPSDPSGHEDCVEM---LSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 35/116 (30%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 37/119 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.