DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and FCER2

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001993.2 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:115 Identity:32/115 - (27%)
Similarity:52/115 - (45%) Gaps:6/115 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVYVSEA 98
            |.||.......|..|...|....|.|:::.|.||.:.|:.|.....| |:.:.:|..:|.:: ..
Human   173 KCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGS-WIGLRNLDLKGEFI-WV 235

  Fly    99 TGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSV-AFIC 147
            .|....:.||:.|||.:.|..:.||   :...|.:.||..|...: |::|
Human   236 DGSHVDYSNWAPGEPTSRSQGEDCV---MMRGSGRWNDAFCDRKLGAWVC 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 32/115 (28%)
FCER2NP_001993.2 CENP-F_leu_zip 48..>148 CDD:463102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
Repetitive region 90..110
Repetitive region 111..131
CLECT 163..282 CDD:214480 31/113 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.