DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Mgl2

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:169 Identity:35/169 - (20%)
Similarity:51/169 - (30%) Gaps:64/169 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSY-----------WLSINDLG 89
            |:.|.::.:|.||..:||.....|:.:.|.||...|...|....|:           |:...|..
Mouse   202 YWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSWMGLTDQNGPWRWVDGTDFD 266

  Fly    90 ERGVYV-------------------SEATGLEAP----------------FLNWSAGEPDNSSGY 119
            :...||                   |:...|..|                |.||...:|||..|:
Mouse   267 KGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSGNMADGQIWSAQFFIFRNWRPLQPDNWHGH 331

  Fly   120 -----DRCVEL-----WLSTTSFQMNDLPCYSSVAFICQ 148
                 :.|...     |        ||..|.....:||:
Mouse   332 MLGGGEDCAHFSYDGRW--------NDDVCQRHYHWICE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 34/167 (20%)
Mgl2XP_006532975.1 Lectin_N 5..180 CDD:461106
CLECT_DC-SIGN_like 190..363 CDD:153060 35/169 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.