DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and Fcer2

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:NP_001029096.1 Gene:Fcer2 / 171075 RGDID:619997 Length:331 Species:Rattus norvegicus


Alignment Length:121 Identity:37/121 - (30%)
Similarity:58/121 - (47%) Gaps:6/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEIGEKQYYISLAKTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGV 93
            |...:|.||.......|.:|...|....|.|:::.|::|.:.|..|::...| |:.:.||...|.
  Rat   191 LHFQQKCYYFGEGSKQWIQAKFTCSDLEGRLVSIHSQKEQDFLMQHINKKES-WIGLQDLNMEGE 254

  Fly    94 YVSEATGLEAPFLNWSAGEPDNSSGYDRCVELWLSTTSFQMNDLPCYSSV-AFICQ 148
            :| ...|....:.|||.|||:|....:.||   :...|.|.||..|.|.: |::|:
  Rat   255 FV-WPDGSPVGYSNWSPGEPNNGGQGEDCV---MMRGSGQWNDAFCRSYLDAWVCE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 35/114 (31%)
Fcer2NP_001029096.1 COG4372 60..>175 CDD:443500
CLECT_DC-SIGN_like 186..306 CDD:153060 36/119 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.