DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-37Db and vcana

DIOPT Version :10

Sequence 1:NP_001014490.1 Gene:lectin-37Db / 3346221 FlyBaseID:FBgn0053533 Length:150 Species:Drosophila melanogaster
Sequence 2:XP_021331663.1 Gene:vcana / 116993 ZFINID:ZDB-GENE-011023-1 Length:8936 Species:Danio rerio


Alignment Length:112 Identity:32/112 - (28%)
Similarity:52/112 - (46%) Gaps:13/112 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 KTNWFEASNHCRQNGGFLLNLESREELELLSPHLHPAYSYWLSINDLGERGVYVSE---ATGLEA 103
            :.||..|...||..|..|.::.|.:|.:.:: .|...|. |:.:||    .::.::   ..|...
Zfish  8716 RRNWDTAERECRLQGAHLASVLSHDEQQYIN-RLGHDYQ-WIGLND----KMFENDFRWTDGRVV 8774

  Fly   104 PFLNWSAGEPDN--SSGYDRCVELWLSTTSFQMNDLPCYSSVAFICQ 148
            .:.||...:||:  |||.|..|.:|  ....|.||:||...:.|.|:
Zfish  8775 QYENWRPNQPDSFFSSGEDCVVMIW--HEDGQWNDVPCNYHLTFTCK 8819

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-37DbNP_001014490.1 CLECT 34..148 CDD:153057 31/110 (28%)
vcanaXP_021331663.1 Ig 31..149 CDD:472250
Ig strand B 40..44 CDD:409482
Ig strand C 66..70 CDD:409482
Ig strand E 110..114 CDD:409482
Ig strand F 124..129 CDD:409482
Ig strand G 142..145 CDD:409482
Link_domain_CSPGs_modules_1_3 147..241 CDD:239594
Link_domain_CSPGs_modules_2_4 249..343 CDD:239597
Herpes_BLLF1 <5897..>6290 CDD:282904
MSCRAMM_ClfA <8105..8452 CDD:468110
EGF 8622..8652 CDD:394967
EGF_CA 8656..8692 CDD:238011
CLECT_CSPGs 8698..8821 CDD:153058 32/112 (29%)
CCP 8825..8881 CDD:153056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.