DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and PJA2

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_055634.3 Gene:PJA2 / 9867 HGNCID:17481 Length:708 Species:Homo sapiens


Alignment Length:70 Identity:21/70 - (30%)
Similarity:35/70 - (50%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AAQDAIANQAENLSMK-RKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKT 127
            |::::|....|.|.:: ...|.:|..|.||...|  ..|.....:.|.|.|...|:..:||::.|
Human   608 ASKESIDGLPETLVLEDHTAIGQEQCCPICCSEY--IKDDIATELPCHHFFHKPCVSIWLQKSGT 670

  Fly   128 CPICK 132
            ||:|:
Human   671 CPVCR 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 16/48 (33%)
PJA2NP_055634.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..90
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..317
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..495
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000269|PubMed:21423175 531..708 21/70 (30%)
Mediates interaction with TBC1D31. /evidence=ECO:0000269|PubMed:33934390 550..570
RING-H2_PJA1_2 633..678 CDD:438128 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..708
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.