DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and ATL3

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_177375.1 Gene:ATL3 / 843563 AraportID:AT1G72310 Length:324 Species:Arabidopsis thaliana


Alignment Length:94 Identity:26/94 - (27%)
Similarity:46/94 - (48%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ITKELRLR---LAAQDAIAN------QAENLSM---KRKKIAEENKCYICKWNYEVTGDHRPVSI 107
            :|:..|.|   :..|||::|      :..:|.:   ::....:..:|.|| .:..|.||...:..
plant    81 VTRRQRRRFIFVPGQDALSNTGLTSFELSSLPIVFFRQDSCKDGLECSIC-LSELVKGDKARLLP 144

  Fly   108 KCGHLFGANCILHYLQRNKTCPICKSQMI 136
            ||.|.|...||..:.|.:.|||||::.::
plant   145 KCNHSFHVECIDMWFQSHSTCPICRNTVL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 18/52 (35%)
ATL3NP_177375.1 RING-H2_EL5-like 126..169 CDD:438124 17/43 (40%)

Return to query results.
Submit another query.