DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT1G72200

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_177365.1 Gene:AT1G72200 / 843552 AraportID:AT1G72200 Length:404 Species:Arabidopsis thaliana


Alignment Length:82 Identity:20/82 - (24%)
Similarity:44/82 - (53%) Gaps:13/82 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 SMKRKKIAEEN-KCYICKWNYEVTGDHRPVSI--KCGHLFGANCILHYLQRNKTCPICKSQMIRC 138
            ::|..:|.:|. :|.:|...:|   |...:.:  ||.|:|...||..:|:.:.|||:|::.:|. 
plant   131 TVKTLRIGKEALECSVCLNEFE---DDETLRLIPKCCHVFHPGCIDAWLRSHTTCPLCRADLIP- 191

  Fly   139 MDVRIIIAGQNLCTAEL 155
                  :.|:::.:.::
plant   192 ------VPGESIVSIQI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/61 (28%)
AT1G72200NP_177365.1 HRD1 <129..288 CDD:227568 20/82 (24%)
RING-H2_EL5-like 143..186 CDD:438124 14/45 (31%)

Return to query results.
Submit another query.